Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Menu
0 items
Victorian Era
2 product(s) found for "Victorian Era"
Late Victorian Era British N..
Victorian Era
Late Victorian Era British N..
Late Victorian Era British Naval Officer Dress Uniform Set w/ Sword SOLD! This beautiful uniform display is sure to please! 1890's style Dress Uniform Coat with Tails, Sword with Queen Victoria Crown on...
$1,895.00
Units in Stock: 0
$1,895.00
Details
Add To Cart
Late Victorian Era British Naval Officer Dress Uniform Set w/ Sword SOLD! This beautiful uniform display is sure to please! 1890's style Dress Uniform Coat with Tails, Sword with Queen Victoria Crown on...
Russian Samovar, Late 1800s
Victorian Era
Russian Samovar, Late 1800s
Original Imperial Russian Tea Samovar Late 1800s, Functional, Romanov, Czar Nicholas II SOLD! This Beautiful, highly detailed, and fully functional antique Russian Samovar will be the central focus of...
$995.00
Units in Stock: 0
$995.00
Details
Add To Cart
Original Imperial Russian Tea Samovar Late 1800s, Functional, Romanov, Czar Nicholas II SOLD! This Beautiful, highly detailed, and fully functional antique Russian Samovar will be the central focus of...
Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i